General Information

  • ID:  hor005327
  • Uniprot ID:  P0DJ94
  • Protein name:  Exendin-1b
  • Gene name:  NA
  • Organism:  Heloderma horridum horridum (Mexican beaded lizard)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Heloderma horridum (species), Heloderma (genus), Helodermatidae (family), Neoanguimorpha, Anguimorpha (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPS
  • Length:  37
  • Propeptide:  HSDATFTAEYSKLLAKLALQKYLESILGSSTSPRPPSS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  T32 O-linked (HexNAc...) serine
  • Mutagenesis:  NA

Activity

  • Function:  They induce hypotension that is mediated by relaxation of cardiac smooth muscle.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0DJ94-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005327_AF2.pdbhor005327_ESM.pdb

Physical Information

Mass: 465083 Formula: C180H288N46O57
Absent amino acids: CMNVW Common amino acids: S
pI: 9.1 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 12
Hydrophobicity: -31.35 Boman Index: -5030
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 84.59
Instability Index: 5835.68 Extinction Coefficient cystines: 2980
Absorbance 280nm: 82.78

Literature

  • PubMed ID:  10880980
  • Title:  Evidence that the lizard helospectin peptides are O-glycosylated.
  • PubMed ID:  9928018
  • Title:   Analogues of VIP, helodermin, and PACAP discriminate between rat and human VIP1 and VIP2 receptors.
  • PubMed ID:  15003357
  • Title:  Helospectin I and II evoke vasodilation in the intact peripheral microcirculation.